Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019763-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MYL2
Alternative Gene Name: CMH10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013936: 98%, ENSRNOG00000030848: 82%
Entrez Gene ID: 4633
Uniprot ID: P10916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE |
| Gene Sequence | GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE |
| Gene ID - Mouse | ENSMUSG00000013936 |
| Gene ID - Rat | ENSRNOG00000030848 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) | |
| Datasheet | Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) | |
| Datasheet | Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) |
| Citations for Anti MYL2 pAb (ATL-HPA019763 w/enhanced validation) – 3 Found |
| Shafa, Mehdi; Yang, Fan; Fellner, Thomas; Rao, Mahendra S; Baghbaderani, Behnam Ahmadian. Human-Induced Pluripotent Stem Cells Manufactured Using a Current Good Manufacturing Practice-Compliant Process Differentiate Into Clinically Relevant Cells From Three Germ Layers. Frontiers In Medicine. 5( 29600249):69. PubMed |
| He, Lingjuan; Tian, Xueying; Zhang, Hui; Hu, Tianyuan; Huang, Xiuzhen; Zhang, Libo; Wang, Zhong; Zhou, Bin. BAF200 is required for heart morphogenesis and coronary artery development. Plos One. 9(10):e109493. PubMed |
| Shafa, Mehdi; Walsh, Tylor; Panchalingam, Krishna Morgan; Richardson, Thomas; Menendez, Laura; Tian, Xinghui; Suresh Babu, Sahana; Dadgar, Saedeh; Beller, Justin; Yang, Fan; Baghbaderani, Behnam Ahmadian. Long-Term Stability and Differentiation Potential of Cryopreserved cGMP-Compliant Human Induced Pluripotent Stem Cells. International Journal Of Molecular Sciences. 2019;21(1) PubMed |