Anti MYH7 pAb (ATL-HPA001239)

Atlas Antibodies

Catalog No.: ATL-HPA001239-25

Protein Description: myosin, heavy chain 7, cardiac muscle, beta
Gene Name: MYH7
Alternative Gene Name: CMD1S, CMH1, MPD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053093: 100%, ENSRNOG00000016983: 100%
Entrez Gene ID: 4625
Uniprot ID: P12883
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
• Gene Sequence: ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
• Gene ID - Mouse: ENSMUSG00000053093
• Gene ID - Rat: ENSRNOG00000016983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYH7 pAb (ATL-HPA001239) – 5 Found

Song, Chao; Qi, Hanping; Liu, Yongsheng; Chen, Yunping; Shi, Pilong; Zhang, Shu; Ren, Jing; Wang, Lixin; Cao, Yonggang; Sun, Hongli. Inhibition of lncRNA Gm15834 Attenuates Autophagy-Mediated Myocardial Hypertrophy via the miR-30b-3p/ULK1 Axis in Mice. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(3):1120-1137. 

Song, Chao; Zhang, Jian; Liu, Yongsheng; Hu, Yinling; Feng, Chenchen; Shi, Pilong; Zhang, Yuexin; Wang, Lixin; Xie, Yawen; Zhang, Meitian; Zhao, Xilong; Cao, Yonggang; Li, Chunquan; Sun, Hongli. Characterization and Validation of ceRNA-Mediated Pathway-Pathway Crosstalk Networks Across Eight Major Cardiovascular Diseases. Frontiers In Cell And Developmental Biology. 10( 35433687):762129. 

Chugh, Shaan; Ouzounian, Maral; Lu, Zhen; Mohamed, Shanas; Li, Wenping; Bousette, Nicolas; Liu, Peter P; Gramolini, Anthony O. Pilot study identifying myosin heavy chain 7, desmin, insulin-like growth factor 7, and annexin A2 as circulating biomarkers of human heart failure. Proteomics. 2013;13(15):2324-34. 

Yuan, Cai; Zhao, Xiaolei; Wang, Zhonghai; Borg, Thomas K; Ye, Tong; Khalpey, Zain I; Runyan, Raymond B; Shao, Yonghong; Gao, Bruce Z. Study of the Expression Transition of Cardiac Myosin Using Polarization-Dependent SHG Microscopy. Biophysical Journal. 2020;118(5):1058-1066. 

Basara, Gozde; Saeidi-Javash, Mortaza; Ren, Xiang; Bahcecioglu, Gokhan; Wyatt, Brian C; Anasori, Babak; Zhang, Yanliang; Zorlutuna, Pinar. Electrically conductive 3D printed Ti(3)C(2)T(x) MXene-PEG composite constructs for cardiac tissue engineering. Acta Biomaterialia. 2022;139( 33352299):179-189.