Anti MYH7 pAb (ATL-HPA001239)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001239-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MYH7
Alternative Gene Name: CMD1S, CMH1, MPD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053093: 100%, ENSRNOG00000016983: 100%
Entrez Gene ID: 4625
Uniprot ID: P12883
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS |
| Gene Sequence | ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS |
| Gene ID - Mouse | ENSMUSG00000053093 |
| Gene ID - Rat | ENSRNOG00000016983 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MYH7 pAb (ATL-HPA001239) | |
| Datasheet | Anti MYH7 pAb (ATL-HPA001239) Datasheet (External Link) |
| Vendor Page | Anti MYH7 pAb (ATL-HPA001239) at Atlas Antibodies |
| Documents & Links for Anti MYH7 pAb (ATL-HPA001239) | |
| Datasheet | Anti MYH7 pAb (ATL-HPA001239) Datasheet (External Link) |
| Vendor Page | Anti MYH7 pAb (ATL-HPA001239) |
| Citations for Anti MYH7 pAb (ATL-HPA001239) – 5 Found |
| Song, Chao; Qi, Hanping; Liu, Yongsheng; Chen, Yunping; Shi, Pilong; Zhang, Shu; Ren, Jing; Wang, Lixin; Cao, Yonggang; Sun, Hongli. Inhibition of lncRNA Gm15834 Attenuates Autophagy-Mediated Myocardial Hypertrophy via the miR-30b-3p/ULK1 Axis in Mice. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(3):1120-1137. PubMed |
| Song, Chao; Zhang, Jian; Liu, Yongsheng; Hu, Yinling; Feng, Chenchen; Shi, Pilong; Zhang, Yuexin; Wang, Lixin; Xie, Yawen; Zhang, Meitian; Zhao, Xilong; Cao, Yonggang; Li, Chunquan; Sun, Hongli. Characterization and Validation of ceRNA-Mediated Pathway-Pathway Crosstalk Networks Across Eight Major Cardiovascular Diseases. Frontiers In Cell And Developmental Biology. 10( 35433687):762129. PubMed |
| Chugh, Shaan; Ouzounian, Maral; Lu, Zhen; Mohamed, Shanas; Li, Wenping; Bousette, Nicolas; Liu, Peter P; Gramolini, Anthony O. Pilot study identifying myosin heavy chain 7, desmin, insulin-like growth factor 7, and annexin A2 as circulating biomarkers of human heart failure. Proteomics. 2013;13(15):2324-34. PubMed |
| Yuan, Cai; Zhao, Xiaolei; Wang, Zhonghai; Borg, Thomas K; Ye, Tong; Khalpey, Zain I; Runyan, Raymond B; Shao, Yonghong; Gao, Bruce Z. Study of the Expression Transition of Cardiac Myosin Using Polarization-Dependent SHG Microscopy. Biophysical Journal. 2020;118(5):1058-1066. PubMed |
| Basara, Gozde; Saeidi-Javash, Mortaza; Ren, Xiang; Bahcecioglu, Gokhan; Wyatt, Brian C; Anasori, Babak; Zhang, Yanliang; Zorlutuna, Pinar. Electrically conductive 3D printed Ti(3)C(2)T(x) MXene-PEG composite constructs for cardiac tissue engineering. Acta Biomaterialia. 2022;139( 33352299):179-189. PubMed |