Anti MYH11 pAb (ATL-HPA015310 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015310-25

Protein Description: myosin, heavy chain 11, smooth muscle
Gene Name: MYH11
Alternative Gene Name: SMHC, SMMHC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018830: 95%, ENSRNOG00000057880: 95%
Entrez Gene ID: 4629
Uniprot ID: P35749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
• Gene Sequence: VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
• Gene ID - Mouse: ENSMUSG00000018830
• Gene ID - Rat: ENSRNOG00000057880
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYH11 pAb (ATL-HPA015310 w/enhanced validation) – 2 Found

Foo, Kylie S; Lehtinen, Miia L; Leung, Chuen Yan; Lian, Xiaojun; Xu, Jiejia; Keung, Wendy; Geng, Lin; Kolstad, Terje R S; Thams, Sebastian; Wong, Andy On-Tik; Wong, Nicodemus; Bylund, Kristine; Zhou, Chikai; He, Xiaobing; Jin, Shao-Bo; Clarke, Jonathan; Lendahl, Urban; Li, Ronald A; Louch, William E; Chien, Kenneth R. Human ISL1(+) Ventricular Progenitors Self-Assemble into an In Vivo Functional Heart Patch and Preserve Cardiac Function Post Infarction. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2018;26(7):1644-1659. 

Dobie, Ross; Wilson-Kanamori, John R; Henderson, Beth E P; Smith, James R; Matchett, Kylie P; Portman, Jordan R; Wallenborg, Karolina; Picelli, Simone; Zagorska, Anna; Pendem, Swetha V; Hudson, Thomas E; Wu, Minnie M; Budas, Grant R; Breckenridge, David G; Harrison, Ewen M; Mole, Damian J; Wigmore, Stephen J; Ramachandran, Prakash; Ponting, Chris P; Teichmann, Sarah A; Marioni, John C; Henderson, Neil C. Single-Cell Transcriptomics Uncovers Zonation of Function in the Mesenchyme during Liver Fibrosis. Cell Reports. 2019;29(7):1832-1847.e8.