Anti MYH10 pAb (ATL-HPA047541 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047541-25

• 
• 

Protein Description: myosin, heavy chain 10, non-muscle
Gene Name: MYH10
Alternative Gene Name: NMMHCB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020900: 96%, ENSRNOG00000002886: 97%
Entrez Gene ID: 4628
Uniprot ID: P35580
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
• Gene Sequence: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ
• Gene ID - Mouse: ENSMUSG00000020900
• Gene ID - Rat: ENSRNOG00000002886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.