Anti MYBL1 pAb (ATL-HPA008791)

Atlas Antibodies

Catalog No.: ATL-HPA008791-25

Protein Description: v-myb avian myeloblastosis viral oncogene homolog-like 1
Gene Name: MYBL1
Alternative Gene Name: A-myb, AMYB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025912: 86%, ENSRNOG00000021669: 85%
Entrez Gene ID: 4603
Uniprot ID: P10243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EANAVLSSLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKNTCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGN
• Gene Sequence: EANAVLSSLQTIPEFAETLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKNTCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGN
• Gene ID - Mouse: ENSMUSG00000025912
• Gene ID - Rat: ENSRNOG00000021669
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYBL1 pAb (ATL-HPA008791) – 8 Found

Mitani, Yoshitsugu; Liu, Bin; Rao, Pulivarthi H; Borra, Vishnupriya J; Zafereo, Mark; Weber, Randal S; Kies, Merrill; Lozano, Guillermina; Futreal, P Andrew; Caulin, Carlos; El-Naggar, Adel K. Novel MYBL1 Gene Rearrangements with Recurrent MYBL1-NFIB Fusions in Salivary Adenoid Cystic Carcinomas Lacking t(6;9) Translocations. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2016;22(3):725-33. 

Guo, Huabei; Zhang, Bing; Nairn, Alison V; Nagy, Tamas; Moremen, Kelley W; Buckhaults, Phillip; Pierce, Michael. O-Linked N-Acetylglucosamine (O-GlcNAc) Expression Levels Epigenetically Regulate Colon Cancer Tumorigenesis by Affecting the Cancer Stem Cell Compartment via Modulating Expression of Transcriptional Factor MYBL1. The Journal Of Biological Chemistry. 2017;292(10):4123-4137. 

Riaz, Muhammad Assad; Stammler, Angelika; Borgers, Mareike; Konrad, Lutz. Clusterin signals via ApoER2/VLDLR and induces meiosis of male germ cells. American Journal Of Translational Research. 9(3):1266-1276. 

Tang, Huanghui; Goldberg, Erwin. A-MYB (MYBL1) stimulates murine testis-specific Ldhc expression via the cAMP-responsive element (CRE) site. Biology Of Reproduction. 2012;86(2):30. 

Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. 

Isbel, Luke; Srivastava, Rahul; Oey, Harald; Spurling, Alex; Daxinger, Lucia; Puthalakath, Hamsa; Whitelaw, Emma. Trim33 Binds and Silences a Class of Young Endogenous Retroviruses in the Mouse Testis; a Novel Component of the Arms Race between Retrotransposons and the Host Genome. Plos Genetics. 2015;11(12):e1005693. 

Özata, Deniz M; Yu, Tianxiong; Mou, Haiwei; Gainetdinov, Ildar; Colpan, Cansu; Cecchini, Katharine; Kaymaz, Yasin; Wu, Pei-Hsuan; Fan, Kaili; Kucukural, Alper; Weng, Zhiping; Zamore, Phillip D. Evolutionarily conserved pachytene piRNA loci are highly divergent among modern humans. Nature Ecology & Evolution. 2020;4(1):156-168. 

Yu, Tianxiong; Biasini, Adriano; Cecchini, Katharine; Saflund, Martin; Mou, Haiwei; Arif, Amena; Eghbali, Atiyeh; de Rooij, Dirk; Weng, Zhiping; Zamore, Phillip D; Ozata, Deniz M. A-MYB/TCFL5 regulatory architecture ensures the production of pachytene piRNAs in placental mammals. Rna (New York, N.y.). 2022;29(1):30-43.