Anti MYBBP1A pAb (ATL-HPA005466 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005466-25

Protein Description: MYB binding protein (P160) 1a
Gene Name: MYBBP1A
Alternative Gene Name: FLJ37886, P160, PAP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040463: 70%, ENSRNOG00000015236: 69%
Entrez Gene ID: 10514
Uniprot ID: Q9BQG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG
• Gene Sequence: EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG
• Gene ID - Mouse: ENSMUSG00000040463
• Gene ID - Rat: ENSRNOG00000015236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYBBP1A pAb (ATL-HPA005466 w/enhanced validation) – 2 Found

Hsieh, Antony; Pitarresi, Jason R; Lerner, Jonathan; Donahue, Greg; Hsiehchen, David; Rustgi, Anil K; Zaret, Kenneth. Growth of pancreatic cancers with hemizygous chromosomal 17p loss of MYBBP1A can be preferentially targeted by PARP inhibitors. Science Advances. 2020;6(49) 

McCarthy, Ryan L; Kaeding, Kelsey E; Keller, Samuel H; Zhong, Yu; Xu, Liqin; Hsieh, Antony; Hou, Yong; Donahue, Greg; Becker, Justin S; Alberto, Oscar; Lim, Bomyi; Zaret, Kenneth S. Diverse heterochromatin-associated proteins repress distinct classes of genes and repetitive elements. Nature Cell Biology. 2021;23(8):905-914.