Anti MX1 pAb (ATL-HPA049724)

Atlas Antibodies

Catalog No.:
ATL-HPA049724-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MX dynamin-like GTPase 1
Gene Name: MX1
Alternative Gene Name: IFI-78K, MxA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000386: 55%, ENSRNOG00000001963: 72%
Entrez Gene ID: 4599
Uniprot ID: P20591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
Gene Sequence MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
Gene ID - Mouse ENSMUSG00000000386
Gene ID - Rat ENSRNOG00000001963
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MX1 pAb (ATL-HPA049724)
Datasheet Anti MX1 pAb (ATL-HPA049724) Datasheet (External Link)
Vendor Page Anti MX1 pAb (ATL-HPA049724) at Atlas Antibodies

Documents & Links for Anti MX1 pAb (ATL-HPA049724)
Datasheet Anti MX1 pAb (ATL-HPA049724) Datasheet (External Link)
Vendor Page Anti MX1 pAb (ATL-HPA049724)