Anti MVD pAb (ATL-HPA048250)

Atlas Antibodies

Catalog No.:
ATL-HPA048250-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mevalonate (diphospho) decarboxylase
Gene Name: MVD
Alternative Gene Name: MPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006517: 89%, ENSRNOG00000013376: 91%
Entrez Gene ID: 4597
Uniprot ID: P53602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGD
Gene Sequence RDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGD
Gene ID - Mouse ENSMUSG00000006517
Gene ID - Rat ENSRNOG00000013376
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MVD pAb (ATL-HPA048250)
Datasheet Anti MVD pAb (ATL-HPA048250) Datasheet (External Link)
Vendor Page Anti MVD pAb (ATL-HPA048250) at Atlas Antibodies

Documents & Links for Anti MVD pAb (ATL-HPA048250)
Datasheet Anti MVD pAb (ATL-HPA048250) Datasheet (External Link)
Vendor Page Anti MVD pAb (ATL-HPA048250)