Anti MUC5B pAb (ATL-HPA008246 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008246-25

Protein Description: mucin 5B, oligomeric mucus/gel-forming
Gene Name: MUC5B
Alternative Gene Name: MG1, MUC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066108: 64%, ENSRNOG00000019846: 64%
Entrez Gene ID: 727897
Uniprot ID: Q9HC84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
• Gene Sequence: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
• Gene ID - Mouse: ENSMUSG00000066108
• Gene ID - Rat: ENSRNOG00000019846
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MUC5B pAb (ATL-HPA008246 w/enhanced validation) – 18 Found

Hynds, Robert E; Ben Aissa, Assma; Gowers, Kate H C; Watkins, Thomas B K; Bosshard-Carter, Leticia; Rowan, Andrew J; Veeriah, Selvaraju; Wilson, Gareth A; Quezada, Sergio A; Swanton, Charles; Janes, Sam M. Expansion of airway basal epithelial cells from primary human non-small cell lung cancer tumors. International Journal Of Cancer. 2018;143(1):160-166. 

Rayner, Rachael E; Makena, Patrudu; Prasad, Gaddamanugu L; Cormet-Boyaka, Estelle. Optimization of Normal Human Bronchial Epithelial (NHBE) Cell 3D Cultures for in vitro Lung Model Studies. Scientific Reports. 2019;9(1):500. 

Wang, Guoqing; Lou, Howard H; Salit, Jacqueline; Leopold, Philip L; Driscoll, Sharon; Schymeinsky, Juergen; Quast, Karsten; Visvanathan, Sudha; Fine, Jay S; Thomas, Matthew J; Crystal, Ronald G. Characterization of an immortalized human small airway basal stem/progenitor cell line with airway region-specific differentiation capacity. Respiratory Research. 2019;20(1):196. 

Burclaff, Joseph; Bliton, R Jarrett; Breau, Keith A; Ok, Meryem T; Gomez-Martinez, Ismael; Ranek, Jolene S; Bhatt, Aadra P; Purvis, Jeremy E; Woosley, John T; Magness, Scott T. A Proximal-to-Distal Survey of Healthy Adult Human Small Intestine and Colon Epithelium by Single-Cell Transcriptomics. Cellular And Molecular Gastroenterology And Hepatology. 13(5):1554-1589. 

Meyerholz, David K; Stoltz, David A; Namati, Eman; Ramachandran, Shyam; Pezzulo, Alejandro A; Smith, Amanda R; Rector, Michael V; Suter, Melissa J; Kao, Simon; McLennan, Geoffrey; Tearney, Guillermo J; Zabner, Joseph; McCray, Paul B Jr; Welsh, Michael J. Loss of cystic fibrosis transmembrane conductance regulator function produces abnormalities in tracheal development in neonatal pigs and young children. American Journal Of Respiratory And Critical Care Medicine. 2010;182(10):1251-61. 

Crowley, Claire; Klanrit, Poramate; Butler, Colin R; Varanou, Aikaterini; Platé, Manuela; Hynds, Robert E; Chambers, Rachel C; Seifalian, Alexander M; Birchall, Martin A; Janes, Sam M. Surface modification of a POSS-nanocomposite material to enhance cellular integration of a synthetic bioscaffold. Biomaterials. 2016;83( 26790147):283-93. 

Yeo, Abrey J; Henningham, Anna; Fantino, Emmanuelle; Galbraith, Sally; Krause, Lutz; Wainwright, Claire E; Sly, Peter D; Lavin, Martin F. Increased susceptibility of airway epithelial cells from ataxia-telangiectasia to S. pneumoniae infection due to oxidative damage and impaired innate immunity. Scientific Reports. 2019;9(1):2627. 

Lodes, Nina; Seidensticker, Katharina; Perniss, Alexander; Nietzer, Sarah; Oberwinkler, Heike; May, Tobias; Walles, Thorsten; Hebestreit, Helge; Hackenberg, Stephan; Steinke, Maria. Investigation on Ciliary Functionality of Different Airway Epithelial Cell Lines in Three-Dimensional Cell Culture. Tissue Engineering. Part A. 2020;26(7-8):432-440. 

Duclos, Grant E; Teixeira, Vitor H; Autissier, Patrick; Gesthalter, Yaron B; Reinders-Luinge, Marjan A; Terrano, Robert; Dumas, Yves M; Liu, Gang; Mazzilli, Sarah A; Brandsma, Corry-Anke; van den Berge, Maarten; Janes, Sam M; Timens, Wim; Lenburg, Marc E; Spira, Avrum; Campbell, Joshua D; Beane, Jennifer. Characterizing smoking-induced transcriptional heterogeneity in the human bronchial epithelium at single-cell resolution. Science Advances. 2019;5(12):eaaw3413. 

Liu, Zhongyu; Anderson, Justin D; Deng, Lily; Mackay, Stephen; Bailey, Johnathan; Kersh, Latona; Rowe, Steven M; Guimbellot, Jennifer S. Human Nasal Epithelial Organoids for Therapeutic Development in Cystic Fibrosis. Genes. 2020;11(6) 

Pharo, Elizabeth A; Williams, Sinéad M; Boyd, Victoria; Sundaramoorthy, Vinod; Durr, Peter A; Baker, Michelle L. Host-Pathogen Responses to Pandemic Influenza H1N1pdm09 in a Human Respiratory Airway Model. Viruses. 2020;12(6) 

Bianchi, Maria; Sivarajan, Rinu; Walles, Thorsten; Hackenberg, Stephan; Steinke, Maria. Susceptibility of primary human airway epithelial cells to Bordetella pertussis adenylate cyclase toxin in two- and three-dimensional culture conditions. Innate Immunity. 2021;27(1):89-98. 

Sponchiado, Mariana; Liao, Yan-Shin; Atanasova, Kalina R; Collins, Emily N; Schurmann, Veronica; Bravo, Laura; Reznikov, Leah R. Overexpression of Substance P in pig airways increases MUC5AC through an NF-kβ pathway. Physiological Reports. 2021;9(3):e14749. 

Ernst, Katharina; Mittler, Ann-Katrin; Winkelmann, Veronika; Kling, Carolin; Eberhardt, Nina; Anastasia, Anna; Sonnabend, Michael; Lochbaum, Robin; Wirsching, Jan; Sakari, Moona; Pulliainen, Arto T; Skerry, Ciaran; Carbonetti, Nicholas H; Frick, Manfred; Barth, Holger. Pharmacological targeting of host chaperones protects from pertussis toxin in vitro and in vivo. Scientific Reports. 2021;11(1):5429. 

Puri, Pawan; Grimmett, Garfield; Faraj, Rawah; Gibson, Laurielle; Gilbreath, Ebony; Yoder, Bradley K. Elevated Protein Kinase A Activity in Stomach Mesenchyme Disrupts Mesenchymal-epithelial Crosstalk and Induces Preneoplasia. Cellular And Molecular Gastroenterology And Hepatology. 14(3):643-668.e1. 

Osan, Jaspreet; Talukdar, Sattya N; Feldmann, Friederike; DeMontigny, Beth Ann; Jerome, Kailey; Bailey, Kristina L; Feldmann, Heinz; Mehedi, Masfique. Goblet Cell Hyperplasia Increases SARS-CoV-2 Infection in Chronic Obstructive Pulmonary Disease. Microbiology Spectrum. 2022;10(4):e0045922. 

Carraro, Gianni; Mulay, Apoorva; Yao, Changfu; Mizuno, Takako; Konda, Bindu; Petrov, Martin; Lafkas, Daniel; Arron, Joe R; Hogaboam, Cory M; Chen, Peter; Jiang, Dianhua; Noble, Paul W; Randell, Scott H; McQualter, Jonathan L; Stripp, Barry R. Single-Cell Reconstruction of Human Basal Cell Diversity in Normal and Idiopathic Pulmonary Fibrosis Lungs. American Journal Of Respiratory And Critical Care Medicine. 2020;202(11):1540-1550. 

Koh, Kyung Duk; Bonser, Luke R; Eckalbar, Walter L; Yizhar-Barnea, Ofer; Shen, Jiangshan; Zeng, Xiaoning; Hargett, Kirsten L; Sun, Dingyuan I; Zlock, Lorna T; Finkbeiner, Walter E; Ahituv, Nadav; Erle, David J. Genomic characterization and therapeutic utilization of IL-13-responsive sequences in asthma. Cell Genomics. 2023;3(1):100229.