Anti MTRF1L pAb (ATL-HPA036367)

Atlas Antibodies

Catalog No.: ATL-HPA036367-25

Protein Description: mitochondrial translational release factor 1-like
Gene Name: MTRF1L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019774: 82%, ENSRNOG00000018773: 80%
Entrez Gene ID: 54516
Uniprot ID: Q9UGC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFMQGDYLLDELVQSLKE
• Gene Sequence: KELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFMQGDYLLDELVQSLKE
• Gene ID - Mouse: ENSMUSG00000019774
• Gene ID - Rat: ENSRNOG00000018773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.