Anti MTMR10 pAb (ATL-HPA006081)

Atlas Antibodies

Catalog No.: ATL-HPA006081-25

Protein Description: myotubularin related protein 10
Gene Name: MTMR10
Alternative Gene Name: FLJ20313
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030522: 86%, ENSRNOG00000016090: 87%
Entrez Gene ID: 54893
Uniprot ID: Q9NXD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESGPESAKKVCLAIAHYSQPTDLQLLFAFEYVGKKYHNSANKINGIPSGDGGGGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGWRVCSINEGYMISTCLPEYIVVPSSLADQ
• Gene Sequence: ESGPESAKKVCLAIAHYSQPTDLQLLFAFEYVGKKYHNSANKINGIPSGDGGGGGGGGNGAGGGSSQKTPLFETYSDWDREIKRTGASGWRVCSINEGYMISTCLPEYIVVPSSLADQ
• Gene ID - Mouse: ENSMUSG00000030522
• Gene ID - Rat: ENSRNOG00000016090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.