Anti MTG2 pAb (ATL-HPA047379)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047379-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MTG2
Alternative Gene Name: dJ1005F21.2, FLJ10741, GTPBP5, ObgH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039069: 86%, ENSRNOG00000059919: 87%
Entrez Gene ID: 26164
Uniprot ID: Q9H4K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV |
Gene Sequence | NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV |
Gene ID - Mouse | ENSMUSG00000039069 |
Gene ID - Rat | ENSRNOG00000059919 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MTG2 pAb (ATL-HPA047379) | |
Datasheet | Anti MTG2 pAb (ATL-HPA047379) Datasheet (External Link) |
Vendor Page | Anti MTG2 pAb (ATL-HPA047379) at Atlas Antibodies |
Documents & Links for Anti MTG2 pAb (ATL-HPA047379) | |
Datasheet | Anti MTG2 pAb (ATL-HPA047379) Datasheet (External Link) |
Vendor Page | Anti MTG2 pAb (ATL-HPA047379) |
Citations for Anti MTG2 pAb (ATL-HPA047379) – 1 Found |
Maiti, Priyanka; Antonicka, Hana; Gingras, Anne-Claude; Shoubridge, Eric A; Barrientos, Antoni. Human GTPBP5 (MTG2) fuels mitoribosome large subunit maturation by facilitating 16S rRNA methylation. Nucleic Acids Research. 2020;48(14):7924-7943. PubMed |