Anti MTG2 pAb (ATL-HPA047379)

Atlas Antibodies

Catalog No.:
ATL-HPA047379-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosome-associated GTPase 2
Gene Name: MTG2
Alternative Gene Name: dJ1005F21.2, FLJ10741, GTPBP5, ObgH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039069: 86%, ENSRNOG00000059919: 87%
Entrez Gene ID: 26164
Uniprot ID: Q9H4K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV
Gene Sequence NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV
Gene ID - Mouse ENSMUSG00000039069
Gene ID - Rat ENSRNOG00000059919
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTG2 pAb (ATL-HPA047379)
Datasheet Anti MTG2 pAb (ATL-HPA047379) Datasheet (External Link)
Vendor Page Anti MTG2 pAb (ATL-HPA047379) at Atlas Antibodies

Documents & Links for Anti MTG2 pAb (ATL-HPA047379)
Datasheet Anti MTG2 pAb (ATL-HPA047379) Datasheet (External Link)
Vendor Page Anti MTG2 pAb (ATL-HPA047379)
Citations for Anti MTG2 pAb (ATL-HPA047379) – 1 Found
Maiti, Priyanka; Antonicka, Hana; Gingras, Anne-Claude; Shoubridge, Eric A; Barrientos, Antoni. Human GTPBP5 (MTG2) fuels mitoribosome large subunit maturation by facilitating 16S rRNA methylation. Nucleic Acids Research. 2020;48(14):7924-7943.  PubMed