Anti MTG2 pAb (ATL-HPA047379)
Atlas Antibodies
- SKU:
- ATL-HPA047379-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/93971/170982/atl-hpa047379_anti-mtg2-pab-atl-hpa047379_52634__68972.1681124768.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue")
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MTG2
Alternative Gene Name: dJ1005F21.2, FLJ10741, GTPBP5, ObgH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039069: 86%, ENSRNOG00000059919: 87%
Entrez Gene ID: 26164
Uniprot ID: Q9H4K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV |
| Gene Sequence | NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV |
| Gene ID - Mouse | ENSMUSG00000039069 |
| Gene ID - Rat | ENSRNOG00000059919 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MTG2 pAb (ATL-HPA047379) | |
| Datasheet | Anti MTG2 pAb (ATL-HPA047379) Datasheet (External Link) |
| Vendor Page | Anti MTG2 pAb (ATL-HPA047379) at Atlas Antibodies |
| Documents & Links for Anti MTG2 pAb (ATL-HPA047379) | |
| Datasheet | Anti MTG2 pAb (ATL-HPA047379) Datasheet (External Link) |
| Vendor Page | Anti MTG2 pAb (ATL-HPA047379) |
| Citations for Anti MTG2 pAb (ATL-HPA047379) – 1 Found |
| Maiti, Priyanka; Antonicka, Hana; Gingras, Anne-Claude; Shoubridge, Eric A; Barrientos, Antoni. Human GTPBP5 (MTG2) fuels mitoribosome large subunit maturation by facilitating 16S rRNA methylation. Nucleic Acids Research. 2020;48(14):7924-7943. PubMed |