Anti MTG1 pAb (ATL-HPA037827)

Atlas Antibodies

Catalog No.:
ATL-HPA037827-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosome-associated GTPase 1
Gene Name: MTG1
Alternative Gene Name: GTPBP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039018: 81%, ENSRNOG00000018860: 87%
Entrez Gene ID: 92170
Uniprot ID: Q9BT17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLVDCIIEVHDARIPLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYH
Gene Sequence KLVDCIIEVHDARIPLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYH
Gene ID - Mouse ENSMUSG00000039018
Gene ID - Rat ENSRNOG00000018860
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTG1 pAb (ATL-HPA037827)
Datasheet Anti MTG1 pAb (ATL-HPA037827) Datasheet (External Link)
Vendor Page Anti MTG1 pAb (ATL-HPA037827) at Atlas Antibodies

Documents & Links for Anti MTG1 pAb (ATL-HPA037827)
Datasheet Anti MTG1 pAb (ATL-HPA037827) Datasheet (External Link)
Vendor Page Anti MTG1 pAb (ATL-HPA037827)