Anti MTCH2 pAb (ATL-HPA038390)

Atlas Antibodies

Catalog No.:
ATL-HPA038390-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial carrier 2
Gene Name: MTCH2
Alternative Gene Name: SLC25A50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111714: 94%, ENSRNOG00000058658: 88%
Entrez Gene ID: 23788
Uniprot ID: Q9Y6C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGP
Gene Sequence VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGP
Gene ID - Mouse ENSMUSG00000111714
Gene ID - Rat ENSRNOG00000058658
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MTCH2 pAb (ATL-HPA038390)
Datasheet Anti MTCH2 pAb (ATL-HPA038390) Datasheet (External Link)
Vendor Page Anti MTCH2 pAb (ATL-HPA038390) at Atlas Antibodies

Documents & Links for Anti MTCH2 pAb (ATL-HPA038390)
Datasheet Anti MTCH2 pAb (ATL-HPA038390) Datasheet (External Link)
Vendor Page Anti MTCH2 pAb (ATL-HPA038390)