Anti MTA3 pAb (ATL-HPA039433)

Atlas Antibodies

Catalog No.: ATL-HPA039433-25

Protein Description: metastasis associated 1 family, member 3
Gene Name: MTA3
Alternative Gene Name: KIAA1266
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055817: 88%, ENSRNOG00000004685: 84%
Entrez Gene ID: 57504
Uniprot ID: Q9BTC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQA
• Gene Sequence: MPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQA
• Gene ID - Mouse: ENSMUSG00000055817
• Gene ID - Rat: ENSRNOG00000004685
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.