Anti MSRB1 pAb (ATL-HPA043463)

Atlas Antibodies

Catalog No.: ATL-HPA043463-25

Protein Description: methionine sulfoxide reductase B1
Gene Name: MSRB1
Alternative Gene Name: SelR, SelX, SepR, SEPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040209: 27%, ENSRNOG00000017419: 24%
Entrez Gene ID: 51734
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP
• Gene Sequence: LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP
• Gene ID - Mouse: ENSMUSG00000040209
• Gene ID - Rat: ENSRNOG00000017419
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.