Anti MSN pAb (ATL-HPA011135 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011135-25

Protein Description: moesin
Gene Name: MSN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031207: 98%, ENSRNOG00000030118: 97%
Entrez Gene ID: 4478
Uniprot ID: P26038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKT
• Gene Sequence: KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKT
• Gene ID - Mouse: ENSMUSG00000031207
• Gene ID - Rat: ENSRNOG00000030118
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MSN pAb (ATL-HPA011135 w/enhanced validation) – 2 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Lenos, Kristiaan J; Bach, Sander; Ferreira Moreno, Leandro; Ten Hoorn, Sanne; Sluiter, Nina R; Bootsma, Sanne; Vieira Braga, Felipe A; Nijman, Lisanne E; van den Bosch, Tom; Miedema, Daniel M; van Dijk, Erik; Ylstra, Bauke; Kulicke, Ruth; Davis, Fred P; Stransky, Nicolas; Smolen, Gromoslaw A; Coebergh van den Braak, Robert R J; IJzermans, Jan N M; Martens, John W M; Hallam, Sally; Beggs, Andrew D; Kops, Geert J P L; Lansu, Nico; Bastiaenen, Vivian P; Klaver, Charlotte E L; Lecca, Maria C; El Makrini, Khalid; Elbers, Clara C; Dings, Mark P G; van Noesel, Carel J M; Kranenburg, Onno; Medema, Jan Paul; Koster, Jan; Koens, Lianne; Punt, Cornelis J A; Tanis, Pieter J; de Hingh, Ignace H; Bijlsma, Maarten F; Tuynman, Jurriaan B; Vermeulen, Louis. Molecular characterization of colorectal cancer related peritoneal metastatic disease. Nature Communications. 2022;13(1):4443.