Anti MSMB pAb (ATL-HPA051257 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051257-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MSMB
Alternative Gene Name: IGBF, MSP, MSPB, PN44, PRPS, PSP, PSP-94, PSP57, PSP94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021907: 47%, ENSRNOG00000039786: 50%
Entrez Gene ID: 4477
Uniprot ID: P08118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK |
| Gene Sequence | LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK |
| Gene ID - Mouse | ENSMUSG00000021907 |
| Gene ID - Rat | ENSRNOG00000039786 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) | |
| Datasheet | Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) | |
| Datasheet | Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) |
| Citations for Anti MSMB pAb (ATL-HPA051257 w/enhanced validation) – 1 Found |
| Wang, Guoqing; Lou, Howard H; Salit, Jacqueline; Leopold, Philip L; Driscoll, Sharon; Schymeinsky, Juergen; Quast, Karsten; Visvanathan, Sudha; Fine, Jay S; Thomas, Matthew J; Crystal, Ronald G. Characterization of an immortalized human small airway basal stem/progenitor cell line with airway region-specific differentiation capacity. Respiratory Research. 2019;20(1):196. PubMed |