Anti MSL2 pAb (ATL-HPA003413)

Atlas Antibodies

Catalog No.: ATL-HPA003413-25

Protein Description: male-specific lethal 2 homolog (Drosophila)
Gene Name: MSL2
Alternative Gene Name: FLJ10546, KIAA1585, msl-2, MSL2L1, RNF184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066415: 98%, ENSRNOG00000023021: 98%
Entrez Gene ID: 55167
Uniprot ID: Q9HCI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
• Gene Sequence: SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETVSNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSEKVQ
• Gene ID - Mouse: ENSMUSG00000066415
• Gene ID - Rat: ENSRNOG00000023021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MSL2 pAb (ATL-HPA003413) – 2 Found

Valsecchi, Claudia Isabelle Keller; Basilicata, M Felicia; Semplicio, Giuseppe; Georgiev, Plamen; Gutierrez, Noel Marie; Akhtar, Asifa. Facultative dosage compensation of developmental genes on autosomes in Drosophila and mouse embryonic stem cells. Nature Communications. 2018;9(1):3626. 

Chelmicki, Tomasz; Dündar, Friederike; Turley, Matthew James; Khanam, Tasneem; Aktas, Tugce; Ramírez, Fidel; Gendrel, Anne-Valerie; Wright, Patrick Rudolf; Videm, Pavankumar; Backofen, Rolf; Heard, Edith; Manke, Thomas; Akhtar, Asifa. MOF-associated complexes ensure stem cell identity and Xist repression. Elife. 2014;3( 24842875):e02024.