Anti MSH5 pAb (ATL-HPA062688)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062688-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MSH5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007035: 83%, ENSRNOG00000000857: 80%
Entrez Gene ID: 4439
Uniprot ID: O43196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK |
| Gene Sequence | METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK |
| Gene ID - Mouse | ENSMUSG00000007035 |
| Gene ID - Rat | ENSRNOG00000000857 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MSH5 pAb (ATL-HPA062688) | |
| Datasheet | Anti MSH5 pAb (ATL-HPA062688) Datasheet (External Link) |
| Vendor Page | Anti MSH5 pAb (ATL-HPA062688) at Atlas Antibodies |
| Documents & Links for Anti MSH5 pAb (ATL-HPA062688) | |
| Datasheet | Anti MSH5 pAb (ATL-HPA062688) Datasheet (External Link) |
| Vendor Page | Anti MSH5 pAb (ATL-HPA062688) |