Anti MSH5 pAb (ATL-HPA062688)

Atlas Antibodies

Catalog No.:
ATL-HPA062688-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mutS homolog 5
Gene Name: MSH5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007035: 83%, ENSRNOG00000000857: 80%
Entrez Gene ID: 4439
Uniprot ID: O43196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK
Gene Sequence METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK
Gene ID - Mouse ENSMUSG00000007035
Gene ID - Rat ENSRNOG00000000857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MSH5 pAb (ATL-HPA062688)
Datasheet Anti MSH5 pAb (ATL-HPA062688) Datasheet (External Link)
Vendor Page Anti MSH5 pAb (ATL-HPA062688) at Atlas Antibodies

Documents & Links for Anti MSH5 pAb (ATL-HPA062688)
Datasheet Anti MSH5 pAb (ATL-HPA062688) Datasheet (External Link)
Vendor Page Anti MSH5 pAb (ATL-HPA062688)