Anti MS4A4A pAb (ATL-HPA029323)

Atlas Antibodies

Catalog No.:
ATL-HPA029323-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: membrane-spanning 4-domains, subfamily A, member 4A
Gene Name: MS4A4A
Alternative Gene Name: CD20L1, MS4A4, MS4A7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101389: 57%, ENSRNOG00000045611: 57%
Entrez Gene ID: 51338
Uniprot ID: Q96JQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV
Gene Sequence SAFGCKVLCCTPGGVVLILPSHSHMAETASPTPLNEV
Gene ID - Mouse ENSMUSG00000101389
Gene ID - Rat ENSRNOG00000045611
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MS4A4A pAb (ATL-HPA029323)
Datasheet Anti MS4A4A pAb (ATL-HPA029323) Datasheet (External Link)
Vendor Page Anti MS4A4A pAb (ATL-HPA029323) at Atlas Antibodies

Documents & Links for Anti MS4A4A pAb (ATL-HPA029323)
Datasheet Anti MS4A4A pAb (ATL-HPA029323) Datasheet (External Link)
Vendor Page Anti MS4A4A pAb (ATL-HPA029323)
Citations for Anti MS4A4A pAb (ATL-HPA029323) – 3 Found
Xiao, Zixuan; Zhang, Wei; Li, Guanzhang; Li, Wendong; Li, Lin; Sun, Ting; He, Yufei; Liu, Guang; Wang, Lu; Han, Xiaohan; Wen, Hao; Liu, Yong; Chen, Yifan; Wang, Haoyu; Li, Jing; Fan, Yubo; Zhang, Jing. Multiomics Analysis Reveals the Prognostic Non-tumor Cell Landscape in Glioblastoma Niches. Frontiers In Genetics. 12( 34603399):741325.  PubMed
Li, Guanzhang; Li, Lin; Li, Yiming; Qian, Zenghui; Wu, Fan; He, Yufei; Jiang, Haoyu; Li, Renpeng; Wang, Di; Zhai, You; Wang, Zhiliang; Jiang, Tao; Zhang, Jing; Zhang, Wei. An MRI radiomics approach to predict survival and tumour-infiltrating macrophages in gliomas. Brain : A Journal Of Neurology. 2022;145(3):1151-1161.  PubMed
Silva-Gomes, Rita; Mapelli, Sarah N; Boutet, Marie-Astrid; Mattiola, Irene; Sironi, Marina; Grizzi, Fabio; Colombo, Federico; Supino, Domenico; Carnevale, Silvia; Pasqualini, Fabio; Stravalaci, Matteo; Porte, Rémi; Gianatti, Andrea; Pitzalis, Constantino; Locati, Massimo; Oliveira, Maria José; Bottazzi, Barbara; Mantovani, Alberto. Differential expression and regulation of MS4A family members in myeloid cells in physiological and pathological conditions. Journal Of Leukocyte Biology. 2022;111(4):817-836.  PubMed