Anti MS4A3 pAb (ATL-HPA019210)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019210-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MS4A3
Alternative Gene Name: CD20L, HTM4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040093: 33%, ENSRNOG00000007486: 33%
Entrez Gene ID: 932
Uniprot ID: Q96HJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK |
| Gene Sequence | MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK |
| Gene ID - Mouse | ENSMUSG00000040093 |
| Gene ID - Rat | ENSRNOG00000007486 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MS4A3 pAb (ATL-HPA019210) | |
| Datasheet | Anti MS4A3 pAb (ATL-HPA019210) Datasheet (External Link) |
| Vendor Page | Anti MS4A3 pAb (ATL-HPA019210) at Atlas Antibodies |
| Documents & Links for Anti MS4A3 pAb (ATL-HPA019210) | |
| Datasheet | Anti MS4A3 pAb (ATL-HPA019210) Datasheet (External Link) |
| Vendor Page | Anti MS4A3 pAb (ATL-HPA019210) |
| Citations for Anti MS4A3 pAb (ATL-HPA019210) – 2 Found |
| Heller, Gerwin; Rommer, Anna; Steinleitner, Katarina; Etzler, Julia; Hackl, Hubert; Heffeter, Petra; Tomasich, Erwin; Filipits, Martin; Steinmetz, Birgit; Topakian, Thais; Klingenbrunner, Simone; Ziegler, Barbara; Spittler, Andreas; Zöchbauer-Müller, Sabine; Berger, Walter; Wieser, Rotraud. EVI1 promotes tumor growth via transcriptional repression of MS4A3. Journal Of Hematology & Oncology. 2015;8( 25886616):28. PubMed |
| Silva-Gomes, Rita; Mapelli, Sarah N; Boutet, Marie-Astrid; Mattiola, Irene; Sironi, Marina; Grizzi, Fabio; Colombo, Federico; Supino, Domenico; Carnevale, Silvia; Pasqualini, Fabio; Stravalaci, Matteo; Porte, Rémi; Gianatti, Andrea; Pitzalis, Constantino; Locati, Massimo; Oliveira, Maria José; Bottazzi, Barbara; Mantovani, Alberto. Differential expression and regulation of MS4A family members in myeloid cells in physiological and pathological conditions. Journal Of Leukocyte Biology. 2022;111(4):817-836. PubMed |