Anti MS4A10 pAb (ATL-HPA014778)

Atlas Antibodies

Catalog No.: ATL-HPA014778-25

Protein Description: membrane-spanning 4-domains, subfamily A, member 10
Gene Name: MS4A10
Alternative Gene Name: CD20L7, MS4A9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024731: 32%, ENSRNOG00000018317: 30%
Entrez Gene ID: 341116
Uniprot ID: Q96PG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKE
• Gene Sequence: KAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKE
• Gene ID - Mouse: ENSMUSG00000024731
• Gene ID - Rat: ENSRNOG00000018317
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MS4A10 pAb (ATL-HPA014778) – 1 Found

Hu, Huan-Fu; Wang, Zheng; Tang, Wen-Li; Fu, Xue-Ming; Kong, Xiang-Jun; Qiu, Ying-Kun; Xi, Sheng-Yan. Effects of Sophora flavescens aiton and the absorbed bioactive metabolite matrine individually and in combination with 5-fluorouracil on proliferation and apoptosis of gastric cancer cells in nude mice. Frontiers In Pharmacology. 13( 36438804):1047507.