Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014341-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: MS4A1
Alternative Gene Name: B1, Bp35, CD20, MS4A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024673: 73%, ENSRNOG00000020945: 77%
Entrez Gene ID: 931
Uniprot ID: P11836
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSP |
| Gene Sequence | ENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSP |
| Gene ID - Mouse | ENSMUSG00000024673 |
| Gene ID - Rat | ENSRNOG00000020945 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) | |
| Datasheet | Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) | |
| Datasheet | Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) |
| Citations for Anti MS4A1 pAb (ATL-HPA014341 w/enhanced validation) – 3 Found |
| Liang, Ye-Lin; Zhang, Yuan; Tan, Xi-Rong; Qiao, Han; Liu, Song-Ran; Tang, Ling-Long; Mao, Yan-Ping; Chen, Lei; Li, Wen-Fei; Zhou, Guan-Qun; Zhao, Yin; Li, Jun-Yan; Li, Qian; Huang, Sheng-Yan; Gong, Sha; Zheng, Zi-Qi; Li, Zhi-Xuan; Sun, Ying; Jiang, Wei; Ma, Jun; Li, Ying-Qin; Liu, Na. A lncRNA signature associated with tumor immune heterogeneity predicts distant metastasis in locoregionally advanced nasopharyngeal carcinoma. Nature Communications. 2022;13(1):2996. PubMed |
| Cameron, S A; White, S M; Arrollo, D; Shulman, S T; Rowley, A H. Arterial immune protein expression demonstrates the complexity of immune responses in Kawasaki disease arteritis. Clinical And Experimental Immunology. 2017;190(2):244-250. PubMed |
| Chen, Yu-Pei; Yin, Jian-Hua; Li, Wen-Fei; Li, Han-Jie; Chen, Dong-Ping; Zhang, Cui-Juan; Lv, Jia-Wei; Wang, Ya-Qin; Li, Xiao-Min; Li, Jun-Yan; Zhang, Pan-Pan; Li, Ying-Qin; He, Qing-Mei; Yang, Xiao-Jing; Lei, Yuan; Tang, Ling-Long; Zhou, Guan-Qun; Mao, Yan-Ping; Wei, Chen; Xiong, Ke-Xu; Zhang, Hong-Bo; Zhu, Shi-Da; Hou, Yong; Sun, Ying; Dean, Michael; Amit, Ido; Wu, Kui; Kuang, Dong-Ming; Li, Gui-Bo; Liu, Na; Ma, Jun. Single-cell transcriptomics reveals regulators underlying immune cell diversity and immune subtypes associated with prognosis in nasopharyngeal carcinoma. Cell Research. 2020;30(11):1024-1042. PubMed |