Anti MRPS31 pAb (ATL-HPA046344)

Atlas Antibodies

Catalog No.: ATL-HPA046344-25

Protein Description: mitochondrial ribosomal protein S31
Gene Name: MRPS31
Alternative Gene Name: IMOGN38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031533: 74%, ENSRNOG00000011839: 67%
Entrez Gene ID: 10240
Uniprot ID: Q92665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS
• Gene Sequence: DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS
• Gene ID - Mouse: ENSMUSG00000031533
• Gene ID - Rat: ENSRNOG00000011839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.