Anti MRPS31 pAb (ATL-HPA046344)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046344-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MRPS31
Alternative Gene Name: IMOGN38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031533: 74%, ENSRNOG00000011839: 67%
Entrez Gene ID: 10240
Uniprot ID: Q92665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS |
Gene Sequence | DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS |
Gene ID - Mouse | ENSMUSG00000031533 |
Gene ID - Rat | ENSRNOG00000011839 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MRPS31 pAb (ATL-HPA046344) | |
Datasheet | Anti MRPS31 pAb (ATL-HPA046344) Datasheet (External Link) |
Vendor Page | Anti MRPS31 pAb (ATL-HPA046344) at Atlas Antibodies |
Documents & Links for Anti MRPS31 pAb (ATL-HPA046344) | |
Datasheet | Anti MRPS31 pAb (ATL-HPA046344) Datasheet (External Link) |
Vendor Page | Anti MRPS31 pAb (ATL-HPA046344) |