Anti MRPS31 pAb (ATL-HPA046344)

Atlas Antibodies

Catalog No.:
ATL-HPA046344-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S31
Gene Name: MRPS31
Alternative Gene Name: IMOGN38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031533: 74%, ENSRNOG00000011839: 67%
Entrez Gene ID: 10240
Uniprot ID: Q92665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS
Gene Sequence DLLGIIKGMKVELSTVNVRTTKPPKRRPLKSLEATLGRLRRATEYAPKKRIEPLSPELVAAASAVADSLPFDKQTTKS
Gene ID - Mouse ENSMUSG00000031533
Gene ID - Rat ENSRNOG00000011839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS31 pAb (ATL-HPA046344)
Datasheet Anti MRPS31 pAb (ATL-HPA046344) Datasheet (External Link)
Vendor Page Anti MRPS31 pAb (ATL-HPA046344) at Atlas Antibodies

Documents & Links for Anti MRPS31 pAb (ATL-HPA046344)
Datasheet Anti MRPS31 pAb (ATL-HPA046344) Datasheet (External Link)
Vendor Page Anti MRPS31 pAb (ATL-HPA046344)