Anti MRPS28 pAb (ATL-HPA027202)

Atlas Antibodies

Catalog No.:
ATL-HPA027202-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein S28
Gene Name: MRPS28
Alternative Gene Name: HSPC007, MRP-S28, MRPS35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040269: 62%, ENSRNOG00000032630: 60%
Entrez Gene ID: 28957
Uniprot ID: Q9Y2Q9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQM
Gene Sequence MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQM
Gene ID - Mouse ENSMUSG00000040269
Gene ID - Rat ENSRNOG00000032630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPS28 pAb (ATL-HPA027202)
Datasheet Anti MRPS28 pAb (ATL-HPA027202) Datasheet (External Link)
Vendor Page Anti MRPS28 pAb (ATL-HPA027202) at Atlas Antibodies

Documents & Links for Anti MRPS28 pAb (ATL-HPA027202)
Datasheet Anti MRPS28 pAb (ATL-HPA027202) Datasheet (External Link)
Vendor Page Anti MRPS28 pAb (ATL-HPA027202)