Anti MRPL51 pAb (ATL-HPA039923)

Atlas Antibodies

Catalog No.:
ATL-HPA039923-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L51
Gene Name: MRPL51
Alternative Gene Name: bMRP64, CDA09, HSPC241, MRP64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030335: 83%, ENSRNOG00000019165: 85%
Entrez Gene ID: 51258
Uniprot ID: Q4U2R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Gene Sequence GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Gene ID - Mouse ENSMUSG00000030335
Gene ID - Rat ENSRNOG00000019165
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL51 pAb (ATL-HPA039923)
Datasheet Anti MRPL51 pAb (ATL-HPA039923) Datasheet (External Link)
Vendor Page Anti MRPL51 pAb (ATL-HPA039923) at Atlas Antibodies

Documents & Links for Anti MRPL51 pAb (ATL-HPA039923)
Datasheet Anti MRPL51 pAb (ATL-HPA039923) Datasheet (External Link)
Vendor Page Anti MRPL51 pAb (ATL-HPA039923)