Anti MRPL47 pAb (ATL-HPA047779)

Atlas Antibodies

SKU: ATL-HPA047779-25

• 
• 

Protein Description: mitochondrial ribosomal protein L47
Gene Name: MRPL47
Alternative Gene Name: CGI-204, NCM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037531: 65%, ENSRNOG00000011639: 63%
Entrez Gene ID: 57129
Uniprot ID: Q9HD33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
• Gene Sequence: YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAEAQKSSLV
• Gene ID - Mouse: ENSMUSG00000037531
• Gene ID - Rat: ENSRNOG00000011639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.