Anti MRPL3 pAb (ATL-HPA043665)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043665-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MRPL3
Alternative Gene Name: MRL3, RPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032563: 86%, ENSRNOG00000012650: 87%
Entrez Gene ID: 11222
Uniprot ID: P09001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGK |
| Gene Sequence | GKSGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGK |
| Gene ID - Mouse | ENSMUSG00000032563 |
| Gene ID - Rat | ENSRNOG00000012650 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MRPL3 pAb (ATL-HPA043665) | |
| Datasheet | Anti MRPL3 pAb (ATL-HPA043665) Datasheet (External Link) |
| Vendor Page | Anti MRPL3 pAb (ATL-HPA043665) at Atlas Antibodies |
| Documents & Links for Anti MRPL3 pAb (ATL-HPA043665) | |
| Datasheet | Anti MRPL3 pAb (ATL-HPA043665) Datasheet (External Link) |
| Vendor Page | Anti MRPL3 pAb (ATL-HPA043665) |
| Citations for Anti MRPL3 pAb (ATL-HPA043665) – 3 Found |
| Van Haute, Lindsey; Hendrick, Alan G; D'Souza, Aaron R; Powell, Christopher A; Rebelo-Guiomar, Pedro; Harbour, Michael E; Ding, Shujing; Fearnley, Ian M; Andrews, Byron; Minczuk, Michal. METTL15 introduces N4-methylcytidine into human mitochondrial 12S rRNA and is required for mitoribosome biogenesis. Nucleic Acids Research. 2019;47(19):10267-10281. PubMed |
| Busch, Jakob D; Cipullo, Miriam; Atanassov, Ilian; Bratic, Ana; Silva Ramos, Eduardo; Schöndorf, Thomas; Li, Xinping; Pearce, Sarah F; Milenkovic, Dusanka; Rorbach, Joanna; Larsson, Nils-Göran. MitoRibo-Tag Mice Provide a Tool for In Vivo Studies of Mitoribosome Composition. Cell Reports. 2019;29(6):1728-1738.e9. PubMed |
| Reyes, Aurelio; Favia, Paola; Vidoni, Sara; Petruzzella, Vittoria; Zeviani, Massimo. RCC1L (WBSCR16) isoforms coordinate mitochondrial ribosome assembly through their interaction with GTPases. Plos Genetics. 2020;16(7):e1008923. PubMed |