Anti MRPL21 pAb (ATL-HPA051657)

Atlas Antibodies

Catalog No.:
ATL-HPA051657-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial ribosomal protein L21
Gene Name: MRPL21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024829: 83%, ENSRNOG00000013845: 82%
Entrez Gene ID: 219927
Uniprot ID: Q7Z2W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVV
Gene Sequence ACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVV
Gene ID - Mouse ENSMUSG00000024829
Gene ID - Rat ENSRNOG00000013845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRPL21 pAb (ATL-HPA051657)
Datasheet Anti MRPL21 pAb (ATL-HPA051657) Datasheet (External Link)
Vendor Page Anti MRPL21 pAb (ATL-HPA051657) at Atlas Antibodies

Documents & Links for Anti MRPL21 pAb (ATL-HPA051657)
Datasheet Anti MRPL21 pAb (ATL-HPA051657) Datasheet (External Link)
Vendor Page Anti MRPL21 pAb (ATL-HPA051657)