Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028811-100

Protein Description: MAS-related GPR, member F
Gene Name: MRGPRF
Alternative Gene Name: GPR140, GPR168, MGC21621, mrgF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031070: 83%, ENSRNOG00000013426: 83%
Entrez Gene ID: 116535
Uniprot ID: Q96AM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP
• Gene Sequence: MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP
• Gene ID - Mouse: ENSMUSG00000031070
• Gene ID - Rat: ENSRNOG00000013426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.