Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028811-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: MAS-related GPR, member F
Gene Name: MRGPRF
Alternative Gene Name: GPR140, GPR168, MGC21621, mrgF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031070: 83%, ENSRNOG00000013426: 83%
Entrez Gene ID: 116535
Uniprot ID: Q96AM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP
Gene Sequence MAGNCSWEAHPGNRNRMCPGLSEAPELYSRGFLTIEQIAMLP
Gene ID - Mouse ENSMUSG00000031070
Gene ID - Rat ENSRNOG00000013426
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation)
Datasheet Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation)
Datasheet Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRGPRF pAb (ATL-HPA028811 w/enhanced validation)