Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004114-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: mannose receptor, C type 1
Gene Name: MRC1
Alternative Gene Name: bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026712: 84%, ENSRNOG00000018251: 86%
Entrez Gene ID: 4360
Uniprot ID: P22897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Gene Sequence NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Gene ID - Mouse ENSMUSG00000026712
Gene ID - Rat ENSRNOG00000018251
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation)
Datasheet Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation)
Datasheet Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation)
Citations for Anti MRC1 pAb (ATL-HPA004114 w/enhanced validation) – 12 Found
Liu, Li; Wei, Qiang; Lin, Qingqing; Fang, Jun; Wang, Haibo; Kwok, Hauyee; Tang, Hangying; Nishiura, Kenji; Peng, Jie; Tan, Zhiwu; Wu, Tongjin; Cheung, Ka-Wai; Chan, Kwok-Hung; Alvarez, Xavier; Qin, Chuan; Lackner, Andrew; Perlman, Stanley; Yuen, Kwok-Yung; Chen, Zhiwei. Anti-spike IgG causes severe acute lung injury by skewing macrophage responses during acute SARS-CoV infection. Jci Insight. 2019;4(4)  PubMed
He, Lizhi; Jhong, Jhih-Hua; Chen, Qi; Huang, Kai-Yao; Strittmatter, Karin; Kreuzer, Johannes; DeRan, Michael; Wu, Xu; Lee, Tzong-Yi; Slavov, Nikolai; Haas, Wilhelm; Marneros, Alexander G. Global characterization of macrophage polarization mechanisms and identification of M2-type polarization inhibitors. Cell Reports. 2021;37(5):109955.  PubMed
Eirin, Alfonso; Williams, Barbara J; Ebrahimi, Behzad; Zhang, Xin; Crane, John A; Lerman, Amir; Textor, Stephen C; Lerman, Lilach O. Mitochondrial targeted peptides attenuate residual myocardial damage after reversal of experimental renovascular hypertension. Journal Of Hypertension. 2014;32(1):154-65.  PubMed
Eirin, Alfonso; Zhang, Xin; Zhu, Xiang-Yang; Tang, Hui; Jordan, Kyra L; Grande, Joseph P; Dietz, Allan B; Lerman, Amir; Textor, Stephen C; Lerman, Lilach O. Renal vein cytokine release as an index of renal parenchymal inflammation in chronic experimental renal artery stenosis. Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2014;29(2):274-82.  PubMed
Cai, Yanhui; Sugimoto, Chie; Arainga, Mariluz; Alvarez, Xavier; Didier, Elizabeth S; Kuroda, Marcelo J. In vivo characterization of alveolar and interstitial lung macrophages in rhesus macaques: implications for understanding lung disease in humans. Journal Of Immunology (Baltimore, Md. : 1950). 2014;192(6):2821-9.  PubMed
Pincus, Seth H; Bhaskaran, Manoj; Brey, Robert N 3rd; Didier, Peter J; Doyle-Meyers, Lara A; Roy, Chad J. Clinical and Pathological Findings Associated with Aerosol Exposure of Macaques to Ricin Toxin. Toxins. 2015;7(6):2121-33.  PubMed
Ortiz-Masiá, Dolores; Gisbert-Ferrándiz, Laura; Bauset, Cristina; Coll, Sandra; Mamie, Céline; Scharl, Michael; Esplugues, Juan V; Alós, Rafael; Navarro, Francisco; Cosín-Roger, Jesús; Barrachina, María D; Calatayud, Sara. Succinate Activates EMT in Intestinal Epithelial Cells through SUCNR1: A Novel Protagonist in Fistula Development. Cells. 2020;9(5)  PubMed
Kovaleva, Olga V; Rashidova, Madina A; Samoilova, Daria V; Podlesnaya, Polina A; Mochalnikova, Valeria V; Gratchev, Alexei. Immunosuppressive Phenotype of Esophagus Tumors Stroma. Analytical Cellular Pathology (Amsterdam). 2020( 32884895):5424780.  PubMed
Kovaleva, Olga; Podlesnaya, Polina; Rashidova, Madina; Samoilova, Daria; Petrenko, Anatoly; Zborovskaya, Irina; Mochalnikova, Valeria; Kataev, Vladimir; Khlopko, Yuri; Plotnikov, Andrey; Gratchev, Alexei. Lung Microbiome Differentially Impacts Survival of Patients with Non-Small Cell Lung Cancer Depending on Tumor Stroma Phenotype. Biomedicines. 2020;8(9)  PubMed
Kovaleva, Olga V; Rashidova, Madina A; Samoilova, Daria V; Podlesnaya, Polina A; Tabiev, Rasul M; Mochalnikova, Valeria V; Gratchev, Alexei. CHID1 Is a Novel Prognostic Marker of Non-Small Cell Lung Cancer. International Journal Of Molecular Sciences. 2021;22(1)  PubMed
Mark, M; Rusakiewicz, S; Früh, M; Hayoz, S; Grosso, F; Pless, M; Zucali, P; Ceresoli, G L; Maconi, A; Schneider, M; Froesch, P; Tarussio, D; Benedetti, F; Dagher, J; Kandalaft, L; von Moos, R; Tissot-Renaud, S; Schmid, S; Metaxas, Y. Long-term benefit of lurbinectedin as palliative chemotherapy in progressive malignant pleural mesothelioma (MPM): final efficacy and translational data of the SAKK 17/16 study. Esmo Open. 2022;7(3):100446.  PubMed
Hung, Chih-Hsing; Hsu, Hua-Yu; Chiou, Hsin-Ying Clair; Tsai, Mei-Lan; You, Huey-Ling; Lin, Yu-Chih; Liao, Wei-Ting; Lin, Yi-Ching. Arsenic Induces M2 Macrophage Polarization and Shifts M1/M2 Cytokine Production via Mitophagy. International Journal Of Molecular Sciences. 2022;23(22)  PubMed