Anti MPP1 pAb (ATL-HPA000167)

Atlas Antibodies

Catalog No.: ATL-HPA000167-25

Protein Description: membrane protein, palmitoylated 1, 55kDa
Gene Name: MPP1
Alternative Gene Name: DXS552E, PEMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031402: 97%, ENSRNOG00000060946: 51%
Entrez Gene ID: 4354
Uniprot ID: Q00013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSS
• Gene Sequence: TEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSS
• Gene ID - Mouse: ENSMUSG00000031402
• Gene ID - Rat: ENSRNOG00000060946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.