Anti MPP1 pAb (ATL-HPA000167)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000167-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MPP1
Alternative Gene Name: DXS552E, PEMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031402: 97%, ENSRNOG00000060946: 51%
Entrez Gene ID: 4354
Uniprot ID: Q00013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSS |
Gene Sequence | TEEMTRNISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSS |
Gene ID - Mouse | ENSMUSG00000031402 |
Gene ID - Rat | ENSRNOG00000060946 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MPP1 pAb (ATL-HPA000167) | |
Datasheet | Anti MPP1 pAb (ATL-HPA000167) Datasheet (External Link) |
Vendor Page | Anti MPP1 pAb (ATL-HPA000167) at Atlas Antibodies |
Documents & Links for Anti MPP1 pAb (ATL-HPA000167) | |
Datasheet | Anti MPP1 pAb (ATL-HPA000167) Datasheet (External Link) |
Vendor Page | Anti MPP1 pAb (ATL-HPA000167) |