Anti MPG pAb (ATL-HPA006531 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006531-25

Protein Description: N-methylpurine-DNA glycosylase
Gene Name: MPG
Alternative Gene Name: MDG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020287: 83%, ENSRNOG00000020571: 84%
Entrez Gene ID: 4350
Uniprot ID: P29372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS
• Gene Sequence: YFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS
• Gene ID - Mouse: ENSMUSG00000020287
• Gene ID - Rat: ENSRNOG00000020571
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MPG pAb (ATL-HPA006531 w/enhanced validation) – 4 Found

Leguisamo, Natalia M; Gloria, Helena C; Kalil, Antonio N; Martins, Talita V; Azambuja, Daniel B; Meira, Lisiane B; Saffi, Jenifer. Base excision repair imbalance in colorectal cancer has prognostic value and modulates response to chemotherapy. Oncotarget. 2017;8(33):54199-54214. 

Healing, Eleanor; Charlier, Clara F; Meira, Lisiane B; Elliott, Ruan M. A panel of colorimetric assays to measure enzymatic activity in the base excision DNA repair pathway. Nucleic Acids Research. 2019;47(11):e61. 

Ström, Cecilia E; Johansson, Fredrik; Uhlén, Mathias; Szigyarto, Cristina Al-Khalili; Erixon, Klaus; Helleday, Thomas. Poly (ADP-ribose) polymerase (PARP) is not involved in base excision repair but PARP inhibition traps a single-strand intermediate. Nucleic Acids Research. 2011;39(8):3166-75. 

van Loon, Barbara; Samson, Leona D. Alkyladenine DNA glycosylase (AAG) localizes to mitochondria and interacts with mitochondrial single-stranded binding protein (mtSSB). Dna Repair. 2013;12(3):177-87.