Anti MORC4 pAb (ATL-HPA050250)

Atlas Antibodies

Catalog No.:
ATL-HPA050250-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: MORC family CW-type zinc finger 4
Gene Name: MORC4
Alternative Gene Name: FLJ11565, ZCW4, ZCWCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031434: 66%, ENSRNOG00000060846: 64%
Entrez Gene ID: 79710
Uniprot ID: Q8TE76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ
Gene Sequence SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ
Gene ID - Mouse ENSMUSG00000031434
Gene ID - Rat ENSRNOG00000060846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MORC4 pAb (ATL-HPA050250)
Datasheet Anti MORC4 pAb (ATL-HPA050250) Datasheet (External Link)
Vendor Page Anti MORC4 pAb (ATL-HPA050250) at Atlas Antibodies

Documents & Links for Anti MORC4 pAb (ATL-HPA050250)
Datasheet Anti MORC4 pAb (ATL-HPA050250) Datasheet (External Link)
Vendor Page Anti MORC4 pAb (ATL-HPA050250)