Anti MORC4 pAb (ATL-HPA050250)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050250-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MORC4
Alternative Gene Name: FLJ11565, ZCW4, ZCWCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031434: 66%, ENSRNOG00000060846: 64%
Entrez Gene ID: 79710
Uniprot ID: Q8TE76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ |
| Gene Sequence | SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ |
| Gene ID - Mouse | ENSMUSG00000031434 |
| Gene ID - Rat | ENSRNOG00000060846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MORC4 pAb (ATL-HPA050250) | |
| Datasheet | Anti MORC4 pAb (ATL-HPA050250) Datasheet (External Link) |
| Vendor Page | Anti MORC4 pAb (ATL-HPA050250) at Atlas Antibodies |
| Documents & Links for Anti MORC4 pAb (ATL-HPA050250) | |
| Datasheet | Anti MORC4 pAb (ATL-HPA050250) Datasheet (External Link) |
| Vendor Page | Anti MORC4 pAb (ATL-HPA050250) |