Anti MORC4 pAb (ATL-HPA050250)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050250-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MORC4
Alternative Gene Name: FLJ11565, ZCW4, ZCWCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031434: 66%, ENSRNOG00000060846: 64%
Entrez Gene ID: 79710
Uniprot ID: Q8TE76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ |
Gene Sequence | SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ |
Gene ID - Mouse | ENSMUSG00000031434 |
Gene ID - Rat | ENSRNOG00000060846 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MORC4 pAb (ATL-HPA050250) | |
Datasheet | Anti MORC4 pAb (ATL-HPA050250) Datasheet (External Link) |
Vendor Page | Anti MORC4 pAb (ATL-HPA050250) at Atlas Antibodies |
Documents & Links for Anti MORC4 pAb (ATL-HPA050250) | |
Datasheet | Anti MORC4 pAb (ATL-HPA050250) Datasheet (External Link) |
Vendor Page | Anti MORC4 pAb (ATL-HPA050250) |