Anti MOCOS pAb (ATL-HPA047958)

Atlas Antibodies

SKU:
ATL-HPA047958-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in gastric parietal cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to cytosol & mitochondria.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: molybdenum cofactor sulfurase
Gene Name: MOCOS
Alternative Gene Name: FLJ20733, HMCS, MOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039616: 80%, ENSRNOG00000015113: 82%
Entrez Gene ID: 55034
Uniprot ID: Q96EN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKK
Gene Sequence NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKK
Gene ID - Mouse ENSMUSG00000039616
Gene ID - Rat ENSRNOG00000015113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MOCOS pAb (ATL-HPA047958)
Datasheet Anti MOCOS pAb (ATL-HPA047958) Datasheet (External Link)
Vendor Page Anti MOCOS pAb (ATL-HPA047958) at Atlas Antibodies

Documents & Links for Anti MOCOS pAb (ATL-HPA047958)
Datasheet Anti MOCOS pAb (ATL-HPA047958) Datasheet (External Link)
Vendor Page Anti MOCOS pAb (ATL-HPA047958)