Anti MOB2 pAb (ATL-HPA046313)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046313-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MOB2
Alternative Gene Name: HCCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025147: 94%, ENSRNOG00000020044: 94%
Entrez Gene ID: 81532
Uniprot ID: Q70IA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT |
Gene Sequence | SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT |
Gene ID - Mouse | ENSMUSG00000025147 |
Gene ID - Rat | ENSRNOG00000020044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MOB2 pAb (ATL-HPA046313) | |
Datasheet | Anti MOB2 pAb (ATL-HPA046313) Datasheet (External Link) |
Vendor Page | Anti MOB2 pAb (ATL-HPA046313) at Atlas Antibodies |
Documents & Links for Anti MOB2 pAb (ATL-HPA046313) | |
Datasheet | Anti MOB2 pAb (ATL-HPA046313) Datasheet (External Link) |
Vendor Page | Anti MOB2 pAb (ATL-HPA046313) |