Anti MOB2 pAb (ATL-HPA046313)

Atlas Antibodies

Catalog No.:
ATL-HPA046313-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: MOB kinase activator 2
Gene Name: MOB2
Alternative Gene Name: HCCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025147: 94%, ENSRNOG00000020044: 94%
Entrez Gene ID: 81532
Uniprot ID: Q70IA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT
Gene Sequence SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT
Gene ID - Mouse ENSMUSG00000025147
Gene ID - Rat ENSRNOG00000020044
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MOB2 pAb (ATL-HPA046313)
Datasheet Anti MOB2 pAb (ATL-HPA046313) Datasheet (External Link)
Vendor Page Anti MOB2 pAb (ATL-HPA046313) at Atlas Antibodies

Documents & Links for Anti MOB2 pAb (ATL-HPA046313)
Datasheet Anti MOB2 pAb (ATL-HPA046313) Datasheet (External Link)
Vendor Page Anti MOB2 pAb (ATL-HPA046313)