Anti MOB2 pAb (ATL-HPA046313)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046313-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MOB2
Alternative Gene Name: HCCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025147: 94%, ENSRNOG00000020044: 94%
Entrez Gene ID: 81532
Uniprot ID: Q70IA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT |
| Gene Sequence | SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT |
| Gene ID - Mouse | ENSMUSG00000025147 |
| Gene ID - Rat | ENSRNOG00000020044 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MOB2 pAb (ATL-HPA046313) | |
| Datasheet | Anti MOB2 pAb (ATL-HPA046313) Datasheet (External Link) |
| Vendor Page | Anti MOB2 pAb (ATL-HPA046313) at Atlas Antibodies |
| Documents & Links for Anti MOB2 pAb (ATL-HPA046313) | |
| Datasheet | Anti MOB2 pAb (ATL-HPA046313) Datasheet (External Link) |
| Vendor Page | Anti MOB2 pAb (ATL-HPA046313) |