Anti MLC1 pAb (ATL-HPA003040 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003040-25

Protein Description: megalencephalic leukoencephalopathy with subcortical cysts 1
Gene Name: MLC1
Alternative Gene Name: KIAA0027, LVM, MLC, VL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035805: 75%, ENSRNOG00000032871: 71%
Entrez Gene ID: 23209
Uniprot ID: Q15049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK
• Gene Sequence: MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK
• Gene ID - Mouse: ENSMUSG00000035805
• Gene ID - Rat: ENSRNOG00000032871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MLC1 pAb (ATL-HPA003040 w/enhanced validation) – 1 Found

Lanciotti, Angela; Brignone, Maria Stefania; Camerini, Serena; Serafini, Barbara; Macchia, Gianfranco; Raggi, Carla; Molinari, Paola; Crescenzi, Marco; Musumeci, Marco; Sargiacomo, Massimo; Aloisi, Francesca; Petrucci, Tamara Corinna; Ambrosini, Elena. MLC1 trafficking and membrane expression in astrocytes: role of caveolin-1 and phosphorylation. Neurobiology Of Disease. 2010;37(3):581-95.