Anti MIOS pAb (ATL-HPA052223)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052223-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MIOS
Alternative Gene Name: FLJ20323
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042447: 98%, ENSRNOG00000007924: 98%
Entrez Gene ID: 54468
Uniprot ID: Q9NXC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD |
Gene Sequence | SISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD |
Gene ID - Mouse | ENSMUSG00000042447 |
Gene ID - Rat | ENSRNOG00000007924 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MIOS pAb (ATL-HPA052223) | |
Datasheet | Anti MIOS pAb (ATL-HPA052223) Datasheet (External Link) |
Vendor Page | Anti MIOS pAb (ATL-HPA052223) at Atlas Antibodies |
Documents & Links for Anti MIOS pAb (ATL-HPA052223) | |
Datasheet | Anti MIOS pAb (ATL-HPA052223) Datasheet (External Link) |
Vendor Page | Anti MIOS pAb (ATL-HPA052223) |