Anti MIOS pAb (ATL-HPA052223)

Atlas Antibodies

Catalog No.:
ATL-HPA052223-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: missing oocyte, meiosis regulator, homolog (Drosophila)
Gene Name: MIOS
Alternative Gene Name: FLJ20323
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042447: 98%, ENSRNOG00000007924: 98%
Entrez Gene ID: 54468
Uniprot ID: Q9NXC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD
Gene Sequence SISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD
Gene ID - Mouse ENSMUSG00000042447
Gene ID - Rat ENSRNOG00000007924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIOS pAb (ATL-HPA052223)
Datasheet Anti MIOS pAb (ATL-HPA052223) Datasheet (External Link)
Vendor Page Anti MIOS pAb (ATL-HPA052223) at Atlas Antibodies

Documents & Links for Anti MIOS pAb (ATL-HPA052223)
Datasheet Anti MIOS pAb (ATL-HPA052223) Datasheet (External Link)
Vendor Page Anti MIOS pAb (ATL-HPA052223)