Anti MIOS pAb (ATL-HPA052223)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052223-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MIOS
Alternative Gene Name: FLJ20323
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042447: 98%, ENSRNOG00000007924: 98%
Entrez Gene ID: 54468
Uniprot ID: Q9NXC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD |
| Gene Sequence | SISYSCSAVPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFTWCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLD |
| Gene ID - Mouse | ENSMUSG00000042447 |
| Gene ID - Rat | ENSRNOG00000007924 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MIOS pAb (ATL-HPA052223) | |
| Datasheet | Anti MIOS pAb (ATL-HPA052223) Datasheet (External Link) |
| Vendor Page | Anti MIOS pAb (ATL-HPA052223) at Atlas Antibodies |
| Documents & Links for Anti MIOS pAb (ATL-HPA052223) | |
| Datasheet | Anti MIOS pAb (ATL-HPA052223) Datasheet (External Link) |
| Vendor Page | Anti MIOS pAb (ATL-HPA052223) |