Anti MIIP pAb (ATL-HPA044948)

Atlas Antibodies

Catalog No.:
ATL-HPA044948-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: migration and invasion inhibitory protein
Gene Name: MIIP
Alternative Gene Name: FLJ12438, IIp45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029022: 59%, ENSRNOG00000047911: 53%
Entrez Gene ID: 60672
Uniprot ID: Q5JXC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
Gene Sequence SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP
Gene ID - Mouse ENSMUSG00000029022
Gene ID - Rat ENSRNOG00000047911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIIP pAb (ATL-HPA044948)
Datasheet Anti MIIP pAb (ATL-HPA044948) Datasheet (External Link)
Vendor Page Anti MIIP pAb (ATL-HPA044948) at Atlas Antibodies

Documents & Links for Anti MIIP pAb (ATL-HPA044948)
Datasheet Anti MIIP pAb (ATL-HPA044948) Datasheet (External Link)
Vendor Page Anti MIIP pAb (ATL-HPA044948)
Citations for Anti MIIP pAb (ATL-HPA044948) – 4 Found
Sun, Yan; Ji, Ping; Chen, Tao; Zhou, Xinhui; Yang, Da; Guo, Yuhong; Liu, Yuexin; Hu, Limei; Xia, Dianren; Liu, Yanxue; Multani, Asha S; Shmulevich, Ilya; Kucherlapati, Raju; Kopetz, Scott; Sood, Anil K; Hamilton, Stanley R; Sun, Baocun; Zhang, Wei. MIIP haploinsufficiency induces chromosomal instability and promotes tumour progression in colorectal cancer. The Journal Of Pathology. 2017;241(1):67-79.  PubMed
Wen, Jing; Fu, Jianhua; Ling, Yihong; Zhang, Wei. MIIP accelerates epidermal growth factor receptor protein turnover and attenuates proliferation in non-small cell lung cancer. Oncotarget. 2016;7(8):9118-34.  PubMed
Chen, Tao; Li, Jingjie; Xu, Meidong; Zhao, Qin; Hou, Yingyong; Yao, Liqing; Zhong, Yunshi; Chou, Ping-Chieh; Zhang, Wei; Zhou, Pinghong; Jiang, Yuhui. PKCε phosphorylates MIIP and promotes colorectal cancer metastasis through inhibition of RelA deacetylation. Nature Communications. 2017;8(1):939.  PubMed
Gao, Yujing; Fang, Yujie; Huang, Yongli; Ma, Rui; Chen, Xixi; Wang, Fang; Pei, Xiuying; Gao, Yuanqi; Chen, Xuehua; Liu, Xinrui; Shan, Jingxuan; Li, Pu. MIIP functions as a novel ligand for ITGB3 to inhibit angiogenesis and tumorigenesis of triple-negative breast cancer. Cell Death & Disease. 2022;13(9):810.  PubMed