Anti MIF pAb (ATL-HPA003868 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003868-25

Protein Description: macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Gene Name: MIF
Alternative Gene Name: GIF, GLIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033307: 89%, ENSRNOG00000056076: 90%
Entrez Gene ID: 4282
Uniprot ID: P14174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
• Gene Sequence: FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
• Gene ID - Mouse: ENSMUSG00000033307
• Gene ID - Rat: ENSRNOG00000056076
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MIF pAb (ATL-HPA003868 w/enhanced validation) – 5 Found

Bourgognon, Julie-Myrtille; Spiers, Jereme G; Scheiblich, Hannah; Antonov, Alexey; Bradley, Sophie J; Tobin, Andrew B; Steinert, Joern R. Alterations in neuronal metabolism contribute to the pathogenesis of prion disease. Cell Death And Differentiation. 2018;25(8):1408-1425. 

Parol-Kulczyk, Martyna; Gzil, Arkadiusz; Maciejewska, Joanna; Bodnar, Magdalena; Grzanka, Dariusz. Clinicopathological significance of the EMT-related proteins and their interrelationships in prostate cancer. An immunohistochemical study. Plos One. 16(6):e0253112. 

Ma, Yue; Visser, Lydia; Roelofsen, Han; de Vries, Marcel; Diepstra, Arjan; van Imhoff, Gustaaf; van der Wal, Tineke; Luinge, Marjan; Alvarez-Llamas, Gloria; Vos, Hans; Poppema, Sibrand; Vonk, Roel; van den Berg, Anke. Proteomics analysis of Hodgkin lymphoma: identification of new players involved in the cross-talk between HRS cells and infiltrating lymphocytes. Blood. 2008;111(4):2339-46. 

Põlajeva, Jelena; Bergström, Tobias; Edqvist, Per-Henrik; Lundequist, Anders; Sjösten, Anna; Nilsson, Gunnar; Smits, Anja; Bergqvist, Michael; Pontén, Fredrik; Westermark, Bengt; Pejler, Gunnar; Forsberg Nilsson, Karin; Tchougounova, Elena. Glioma-derived macrophage migration inhibitory factor (MIF) promotes mast cell recruitment in a STAT5-dependent manner. Molecular Oncology. 2014;8(1):50-8. 

Klemke, Luisa; De Oliveira, Tiago; Witt, Daria; Winkler, Nadine; Bohnenberger, Hanibal; Bucala, Richard; Conradi, Lena-Christin; Schulz-Heddergott, Ramona. Hsp90-stabilized MIF supports tumor progression via macrophage recruitment and angiogenesis in colorectal cancer. Cell Death & Disease. 2021;12(2):155.