Anti MIER1 pAb (ATL-HPA050306)

Atlas Antibodies

Catalog No.:
ATL-HPA050306-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mesoderm induction early response 1, transcriptional regulator
Gene Name: MIER1
Alternative Gene Name: hMI-ER1, KIAA1610, MI-ER1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028522: 89%, ENSRNOG00000007175: 87%
Entrez Gene ID: 57708
Uniprot ID: Q8N108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Gene Sequence GPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRRVNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Gene ID - Mouse ENSMUSG00000028522
Gene ID - Rat ENSRNOG00000007175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MIER1 pAb (ATL-HPA050306)
Datasheet Anti MIER1 pAb (ATL-HPA050306) Datasheet (External Link)
Vendor Page Anti MIER1 pAb (ATL-HPA050306) at Atlas Antibodies

Documents & Links for Anti MIER1 pAb (ATL-HPA050306)
Datasheet Anti MIER1 pAb (ATL-HPA050306) Datasheet (External Link)
Vendor Page Anti MIER1 pAb (ATL-HPA050306)