Anti MICU3 pAb (ATL-HPA024771)

Atlas Antibodies

Catalog No.: ATL-HPA024771-25

Protein Description: mitochondrial calcium uptake family, member 3
Gene Name: MICU3
Alternative Gene Name: DKFZp313A0139, EFHA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039478: 97%, ENSRNOG00000012767: 65%
Entrez Gene ID: 286097
Uniprot ID: Q86XE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRS
• Gene Sequence: RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRS
• Gene ID - Mouse: ENSMUSG00000039478
• Gene ID - Rat: ENSRNOG00000012767
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.