Anti MICU2 pAb (ATL-HPA045511)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045511-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MICU2
Alternative Gene Name: EFHA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021973: 80%, ENSRNOG00000011168: 76%
Entrez Gene ID: 221154
Uniprot ID: Q8IYU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT |
| Gene Sequence | LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT |
| Gene ID - Mouse | ENSMUSG00000021973 |
| Gene ID - Rat | ENSRNOG00000011168 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MICU2 pAb (ATL-HPA045511) | |
| Datasheet | Anti MICU2 pAb (ATL-HPA045511) Datasheet (External Link) |
| Vendor Page | Anti MICU2 pAb (ATL-HPA045511) at Atlas Antibodies |
| Documents & Links for Anti MICU2 pAb (ATL-HPA045511) | |
| Datasheet | Anti MICU2 pAb (ATL-HPA045511) Datasheet (External Link) |
| Vendor Page | Anti MICU2 pAb (ATL-HPA045511) |
| Citations for Anti MICU2 pAb (ATL-HPA045511) – 4 Found |
| Vais, Horia; Mallilankaraman, Karthik; Mak, Don-On Daniel; Hoff, Henry; Payne, Riley; Tanis, Jessica E; Foskett, J Kevin. EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter. Cell Reports. 2016;14(3):403-410. PubMed |
| Naon, Deborah; Zaninello, Marta; Giacomello, Marta; Varanita, Tatiana; Grespi, Francesca; Lakshminaranayan, Sowmya; Serafini, Annalisa; Semenzato, Martina; Herkenne, Stephanie; Hernández-Alvarez, Maria Isabel; Zorzano, Antonio; De Stefani, Diego; Dorn, Gerald W 2nd; Scorrano, Luca. Critical reappraisal confirms that Mitofusin 2 is an endoplasmic reticulum-mitochondria tether. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(40):11249-11254. PubMed |
| Di Marco, Giulia; Vallese, Francesca; Jourde, Benjamin; Bergsdorf, Christian; Sturlese, Mattia; De Mario, Agnese; Techer-Etienne, Valerie; Haasen, Dorothea; Oberhauser, Berndt; Schleeger, Simone; Minetti, Giulia; Moro, Stefano; Rizzuto, Rosario; De Stefani, Diego; Fornaro, Mara; Mammucari, Cristina. A High-Throughput Screening Identifies MICU1 Targeting Compounds. Cell Reports. 2020;30(7):2321-2331.e6. PubMed |
| Liu, Cong; Li, Hui-Juan; Duan, Wei-Xia; Duan, Yu; Yu, Qin; Zhang, Tian; Sun, Ya-Pei; Li, Yuan-Yuan; Liu, Yong-Sheng; Xu, Shang-Cheng. MCU Upregulation Overactivates Mitophagy by Promoting VDAC1 Dimerization and Ubiquitination in the Hepatotoxicity of Cadmium. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2023;10(7):e2203869. PubMed |