Anti MICU2 pAb (ATL-HPA045511)

Atlas Antibodies

Catalog No.:
ATL-HPA045511-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mitochondrial calcium uptake 2
Gene Name: MICU2
Alternative Gene Name: EFHA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021973: 80%, ENSRNOG00000011168: 76%
Entrez Gene ID: 221154
Uniprot ID: Q8IYU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT
Gene Sequence LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT
Gene ID - Mouse ENSMUSG00000021973
Gene ID - Rat ENSRNOG00000011168
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MICU2 pAb (ATL-HPA045511)
Datasheet Anti MICU2 pAb (ATL-HPA045511) Datasheet (External Link)
Vendor Page Anti MICU2 pAb (ATL-HPA045511) at Atlas Antibodies

Documents & Links for Anti MICU2 pAb (ATL-HPA045511)
Datasheet Anti MICU2 pAb (ATL-HPA045511) Datasheet (External Link)
Vendor Page Anti MICU2 pAb (ATL-HPA045511)
Citations for Anti MICU2 pAb (ATL-HPA045511) – 4 Found
Vais, Horia; Mallilankaraman, Karthik; Mak, Don-On Daniel; Hoff, Henry; Payne, Riley; Tanis, Jessica E; Foskett, J Kevin. EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter. Cell Reports. 2016;14(3):403-410.  PubMed
Naon, Deborah; Zaninello, Marta; Giacomello, Marta; Varanita, Tatiana; Grespi, Francesca; Lakshminaranayan, Sowmya; Serafini, Annalisa; Semenzato, Martina; Herkenne, Stephanie; Hernández-Alvarez, Maria Isabel; Zorzano, Antonio; De Stefani, Diego; Dorn, Gerald W 2nd; Scorrano, Luca. Critical reappraisal confirms that Mitofusin 2 is an endoplasmic reticulum-mitochondria tether. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(40):11249-11254.  PubMed
Di Marco, Giulia; Vallese, Francesca; Jourde, Benjamin; Bergsdorf, Christian; Sturlese, Mattia; De Mario, Agnese; Techer-Etienne, Valerie; Haasen, Dorothea; Oberhauser, Berndt; Schleeger, Simone; Minetti, Giulia; Moro, Stefano; Rizzuto, Rosario; De Stefani, Diego; Fornaro, Mara; Mammucari, Cristina. A High-Throughput Screening Identifies MICU1 Targeting Compounds. Cell Reports. 2020;30(7):2321-2331.e6.  PubMed
Liu, Cong; Li, Hui-Juan; Duan, Wei-Xia; Duan, Yu; Yu, Qin; Zhang, Tian; Sun, Ya-Pei; Li, Yuan-Yuan; Liu, Yong-Sheng; Xu, Shang-Cheng. MCU Upregulation Overactivates Mitophagy by Promoting VDAC1 Dimerization and Ubiquitination in the Hepatotoxicity of Cadmium. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2023;10(7):e2203869.  PubMed