Anti MICU1 pAb (ATL-HPA037479 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037479-25

Protein Description: mitochondrial calcium uptake 1
Gene Name: MICU1
Alternative Gene Name: CALC, CBARA1, EFHA3, FLJ12684
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020111: 99%, ENSRNOG00000043436: 100%
Entrez Gene ID: 10367
Uniprot ID: Q9BPX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTY
• Gene Sequence: IFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTY
• Gene ID - Mouse: ENSMUSG00000020111
• Gene ID - Rat: ENSRNOG00000043436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MICU1 pAb (ATL-HPA037479 w/enhanced validation) – 4 Found

Chiu, Hsin Yao; Loh, Amos Hong Pheng; Taneja, Reshma. Mitochondrial calcium uptake regulates tumour progression in embryonal rhabdomyosarcoma. Cell Death & Disease. 2022;13(4):419. 

Natarajan, Venkateswaran; Mah, Tania; Peishi, Chen; Tan, Shu Yi; Chawla, Ritu; Arumugam, Thiruma Valavan; Ramasamy, Adaikalavan; Mallilankaraman, Karthik. Oxygen Glucose Deprivation Induced Prosurvival Autophagy Is Insufficient to Rescue Endothelial Function. Frontiers In Physiology. 11( 33041854):533683. 

Butera, Gaia; Vecellio Reane, Denis; Canato, Marta; Pietrangelo, Laura; Boncompagni, Simona; Protasi, Feliciano; Rizzuto, Rosario; Reggiani, Carlo; Raffaello, Anna. Parvalbumin affects skeletal muscle trophism through modulation of mitochondrial calcium uptake. Cell Reports. 2021;35(5):109087. 

Cartes-Saavedra, Benjamín; Macuada, Josefa; Lagos, Daniel; Arancibia, Duxan; Andrés, María E; Yu-Wai-Man, Patrick; Hajnóczky, György; Eisner, Verónica. OPA1 Modulates Mitochondrial Ca(2+) Uptake Through ER-Mitochondria Coupling. Frontiers In Cell And Developmental Biology. 9( 35047497):774108.