Anti MGST2 pAb (ATL-HPA010707)

Atlas Antibodies

Catalog No.: ATL-HPA010707-25

Protein Description: microsomal glutathione S-transferase 2
Gene Name: MGST2
Alternative Gene Name: MGST-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074604: 73%, ENSRNOG00000061857: 76%
Entrez Gene ID: 4258
Uniprot ID: Q99735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
• Gene Sequence: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
• Gene ID - Mouse: ENSMUSG00000074604
• Gene ID - Rat: ENSRNOG00000061857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MGST2 pAb (ATL-HPA010707) – 1 Found

Dvash, Efrat; Har-Tal, Michal; Barak, Sara; Meir, Ofir; Rubinstein, Menachem. Leukotriene C4 is the major trigger of stress-induced oxidative DNA damage. Nature Communications. 2015;6( 26656251):10112.