Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044840-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: microsomal glutathione S-transferase 1
Gene Name: MGST1
Alternative Gene Name: GST12, MGST-I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008540: 73%, ENSRNOG00000007743: 79%
Entrez Gene ID: 4257
Uniprot ID: P10620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR
Gene Sequence FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR
Gene ID - Mouse ENSMUSG00000008540
Gene ID - Rat ENSRNOG00000007743
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation)
Datasheet Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation)
Datasheet Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation)
Citations for Anti MGST1 pAb (ATL-HPA044840 w/enhanced validation) – 1 Found
Stafiej, Joanna; Hałas-Wiśniewska, Marta; Izdebska, Magdalena; Gagat, Maciej; Grzanka, Dariusz; Grzanka, Alina; Malukiewicz, Grażyna. Immunohistochemical analysis of microsomal glutathione S-transferase 1 and clusterin expression in lens epithelial cells of patients with pseudoexfoliation syndrome. Experimental And Therapeutic Medicine. 2017;13(3):1057-1063.  PubMed