Anti MGRN1 pAb (ATL-HPA007653)

Atlas Antibodies

Catalog No.: ATL-HPA007653-25

Protein Description: mahogunin ring finger 1, E3 ubiquitin protein ligase
Gene Name: MGRN1
Alternative Gene Name: KIAA0544, RNF156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022517: 88%, ENSRNOG00000003234: 89%
Entrez Gene ID: 23295
Uniprot ID: O60291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDE
• Gene Sequence: LPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDE
• Gene ID - Mouse: ENSMUSG00000022517
• Gene ID - Rat: ENSRNOG00000003234
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.