Anti MGEA5 pAb (ATL-HPA036141)

Atlas Antibodies

Catalog No.: ATL-HPA036141-25

Protein Description: meningioma expressed antigen 5 (hyaluronidase)
Gene Name: MGEA5
Alternative Gene Name: MEA5, NCOAT, OGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025220: 100%, ENSRNOG00000017822: 100%
Entrez Gene ID: 10724
Uniprot ID: O60502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVM
• Gene Sequence: WTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVM
• Gene ID - Mouse: ENSMUSG00000025220
• Gene ID - Rat: ENSRNOG00000017822
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MGEA5 pAb (ATL-HPA036141) – 4 Found

Itkonen, Harri M; Gorad, Saurabh S; Duveau, Damien Y; Martin, Sara E S; Barkovskaya, Anna; Bathen, Tone F; Moestue, Siver A; Mills, Ian G. Inhibition of O-GlcNAc transferase activity reprograms prostate cancer cell metabolism. Oncotarget. 2016;7(11):12464-76. 

Itkonen, Harri M; Urbanucci, Alfonso; Martin, Sara Es; Khan, Aziz; Mathelier, Anthony; Thiede, Bernd; Walker, Suzanne; Mills, Ian G. High OGT activity is essential for MYC-driven proliferation of prostate cancer cells. Theranostics. 9(8):2183-2197. 

Weiss, Matjaž; Anderluh, Marko; Gobec, Martina. Inhibition of O-GlcNAc Transferase Alters the Differentiation and Maturation Process of Human Monocyte Derived Dendritic Cells. Cells. 2021;10(12) 

Muha, Villő; Authier, Florence; Szoke-Kovacs, Zsombor; Johnson, Sara; Gallagher, Jennifer; McNeilly, Alison; McCrimmon, Rory J; Teboul, Lydia; van Aalten, Daan M F. Loss of O-GlcNAcase catalytic activity leads to defects in mouse embryogenesis. The Journal Of Biological Chemistry. 2021;296( 33610549):100439.