Anti MFSD12 pAb (ATL-HPA042149)

Atlas Antibodies

Catalog No.:
ATL-HPA042149-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: major facilitator superfamily domain containing 12
Gene Name: MFSD12
Alternative Gene Name: C19orf28, MGC20700, PP3501
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034245: 27%, ENSRNOG00000001769: 31%
Entrez Gene ID: 126321
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLAWRRGRGEDKGPGYSWIPTVLVQPPRPTSPFLWEAPLAWRCTRKKWSGAGTKPWPRED
Gene Sequence FLAWRRGRGEDKGPGYSWIPTVLVQPPRPTSPFLWEAPLAWRCTRKKWSGAGTKPWPRED
Gene ID - Mouse ENSMUSG00000034245
Gene ID - Rat ENSRNOG00000001769
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MFSD12 pAb (ATL-HPA042149)
Datasheet Anti MFSD12 pAb (ATL-HPA042149) Datasheet (External Link)
Vendor Page Anti MFSD12 pAb (ATL-HPA042149) at Atlas Antibodies

Documents & Links for Anti MFSD12 pAb (ATL-HPA042149)
Datasheet Anti MFSD12 pAb (ATL-HPA042149) Datasheet (External Link)
Vendor Page Anti MFSD12 pAb (ATL-HPA042149)